AKR1B15 Rabbit Polyclonal Antibody TA332216 from OriGene Technologies | Biocompare.com

Supplier Images

AKR1B15 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
AKR1B15 Rabbit Polyclonal Antibody

OriGene Technologies' AKR1B15 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The AKR1B15 Rabbit Polyclonal Antibody was generated using AKR1B15 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-AKR1B15 Antibody

Product Specs
ItemAKR1B15 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA332216
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetAKR1B15
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-AKR1B15 Antibody is: synthetic peptide directed towards the C-terminal region of Human AKR1B15. Synthetic peptide located within the following region: TAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRN
NCBI Full Gene Namealdo-keto reductase family 1 member B15
NCBI Gene AliasesAKR1B10L, AKR1R1B7, AKR1B10L, AK1R1B7
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!